Differences between revisions 3 and 6 (spanning 3 versions)
Revision 3 as of 2005-07-11 17:18:31
Size: 4440
Editor: 203
Comment: FastaConvertor added
Revision 6 as of 2005-07-19 15:39:07
Size: 4998
Editor: 203
Comment: add simple iterator
Deletions are marked like this. Additions are marked like this.
Line 96: Line 96:
 * [http://biohackers.net/yongslib/wiki/FastaConvertor FastaConvertor]
간단한 [Iterator]
{{{#!python
from cStringIO import StringIO
class FastaIterator:
    def __init__(self, ifile):
        self.ifile = ifile
        self.g = self.getGenerator()
    def getGenerator(self):
        lines = [self.ifile.next()]
        for line in self.ifile:
            if line.startswith('>'):
                yield ''.join(lines)
                lines = [line]
            else:
                lines.append(line)
        else:
            yield ''.join(lines)
    def next(self):
        return self.g.next()
}}}

각종 변환 프로그램(using WxPython) --> YongsLib:FastaConvertor

[FASTA] format.

A sequence in FastaFormat begins with a single-line description, followed by lines of sequence data. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column. It is recommended that all lines of text be shorter than 80 characters in length. An example sequence is:

>gi|532319|pir|TVFV2E|TVFV2E envelope protein
ELRLRYCAPAGFALLKCNDADYDGFKTNCSNVSVVHCTNLMNTTVTTGLLLNGSYSENRT
QIWQKHRTSNDSALILLNKHYNLTVTCKRPGNKTVLPVTIMAGLVFHSQKYNLRLRQAWC
HFPSNWKGAWKEVKEEIVNLPKERYRGTNDPKRIFFQRQWGDPETANLWFNCHGEFFYCK
MDWFLNYLNNLTVDADHNECKNTSGTKSGNKRAPGPCVQRTYVACHIRSVIIWLETISKK
TYAPPREGHLECTSTVTGMTVELNYIPKNRTNVTLSPQIESIWAAELDRYKLVEITPIGF
APTEVRRYTGGHERQKRVPFVXXXXXXXXXXXXXXXXXXXXXXVQSQHLLAGILQQQKNL
LAAVEAQQQMLKLTIWGVK

BioSequence is expected to be represented in the standard IUB/IUPAC AminoAcid and NucleicAcid codes, with these exceptions: lower-case letters are accepted and are mapped into upper-case; a single hyphen or dash can be used to represent a gap of indeterminate length; and in AminoAcid sequences, U and * are acceptable letters (see below). Before submitting a request, any numerical digits in the query sequence should either be removed or replaced by appropriate letter codes (e.g., N for unknown NucleicAcid residue or X for unknown AminoAcid residue).

BioPython을 써서 FastaFormat다루기

BioPython으로 FastaFormat을 다루는 요령은 다음과 같다.

입력할때 - 주로 FastaFormat의 [Parsing]

   1 from Bio import Fasta, File
   2 from cStringIO import StringIO 
   3 #file = File.UndoHandle(StringIO(fastaStr)) # 만일 스트링으로 갖고있을경우
   4 file = open('file.fasta', 'r') 
   5 parser = Fasta.RecordParser() 
   6 iterator = Fasta.Iterator(file, parser) 
   7 while 1: 
   8     curRecord = iterator.next()  # 하나의 fasta file내에 여러개의 record를 반복적으로 접근 
   9     if curRecord is None: break 
  10     title = curRecord.title   # 레코드에서 타이틀 
  11     seq = curRecord.sequence  # 레코드에서 서열 

출력할때 - stdout으로 뿌려준다면

   1 from Bio import Fasta 
   2 title = '>This is test title'  # fasta file의 title 
   3 seq = 'ATGGGGGTGTGTGTGGGG' # 하나의 긴 문자열 
   4 fasta = Fasta.Record()   # fasta라는 인스턴스를 만듦 
   5 fasta.title = title              # 강제로 title속성에 값을 부여 
   6 fasta.sequence = seq    # 마찬가지 
   7 print fasta                     # 이 명령으로 60자리후의 '\n'입력까지 자동으로 된다. 
   8 
   9 # if you want to write on file
  10 wfile = open('쓰고자하는파일', 'w') 
  11 wfile.write(str(fasta))

RelationalDatabase에서 직접만들기

SELECT CONCAT(">gi|", annot.gi, "|sp|", annot.acc, "|", sp.name, " ", annot.descr, "\n", protein.seq)
FROM   protein INNER JOIN annot USING (prot_id) INNER JOIN sp USING (acc)
WHERE  annot.current = 1;
$ mysql seqdb -N < swissprot.sql > swissprot.fa

관련코드모음

[HTML]로 FastaFormat꾸미기

  • DecoratorPattern 이용 : [FastaDecorator.py]

  • JuneKim씨 코드(2004-06-13) : 파이썬 커뮤니티에 정규식 중에 중간에 개행문자가 들어와도 되는 경우를 물으셨더군요. 다음과 같이 할 수도 있습니다.

       1 import re
       2 
       3 class Enclose:
       4     def __init__(self,d):
       5         self.d=[(v,self.fragmentable(k)) for k,v in d]
       6         self.p=re.compile("(?i)(%s)"%")|(".join([f for _,f in self.d]))
       7     def fragmentable(self,s): return '\s?'.join(list(s))
       8     def __call__(self, m):
       9         opener,closer=self.d[m.lastindex-1][0]
      10         return "%s%s%s"%(opener,m.group(),closer)
      11     def do(self, text):
      12         return self.p.sub(self, text)
      13 
      14 if __name__ == "__main__": 
      15     sequence = """\
      16 TCTTCTCCTCACCTCGCTCTCGCCGCCTGCTCGCCCCGNCCGCTTTGCTCGGCGCCCCAA
      17 AACACNCTTCCACCATGNGCCACCTCGGCGAGCCCTCCCACTTGAACAAAGGGGTGCTCG
      18 GCGCGTGTACNNATGGCCC\
      19 """
      20     expected="""TCTTCTCCTCACCTCGCTCTCGCCGCCTGCTCGCCCCGNCCGCTTTGCTCGGCG<b>CCCCAA
      21 AACACN</b>CTTCCACCATGNGCC<font color="red">ACCTCGGCGAGCC</font>CTCCCACTTGAACAAAGGGGTGC<i>TCG
      22 GCGCGTG</i>TACNNATGGCCC"""
      23 
      24     d=(('CCCCAAAACACN',('<b>','</b>')),
      25        ('TCGGCGCGTG',('<i>','</i>')),
      26        ('ACCTCGGCGAGCC',('<font color="red">','</font>')),
      27        )
      28 
      29     r=Enclose(d).do(sequence)
      30     assert r==expected
    

간단한 [Iterator]

   1 from cStringIO import StringIO
   2 class FastaIterator:
   3     def __init__(self, ifile):
   4         self.ifile = ifile
   5         self.g = self.getGenerator()
   6     def getGenerator(self):
   7         lines = [self.ifile.next()]
   8         for line in self.ifile:
   9             if line.startswith('>'):
  10                 yield ''.join(lines)
  11                 lines = [line]
  12             else:
  13                 lines.append(line)
  14         else:
  15             yield ''.join(lines)
  16     def next(self):
  17         return self.g.next()

각종 변환 프로그램(using WxPython) --> FastaConvertor

FastaFormat (last edited 2012-06-13 18:09:58 by 61)